General Information

  • ID:  hor001320
  • Uniprot ID:  A0A6P6RJ32
  • Protein name:  Goldfish LPXRFa peptide-3
  • Gene name:  LOC113120076
  • Organism:  Carassius auratus (Goldfish)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  Brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SGTGLSATLPQRF
  • Length:  13(111-123)
  • Propeptide:  MLREVTALRWPLPDDSDPDRFTWGQFLENAQEIPRSLEIEDFTLNVAPTSGRVSSPTILRLHPKITKPTHLHANLPLRFGRDTENTPRERAKSNINLPQRFGRSCTMCARSGTGLSATLPQRFGRRNIFPLDPFRALTLYKRTPESPFPKERTQVHDYMLETVEDSVEETVKNKDYTVLD
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Possess multiple regulatory functions and act, at least partly, on the pituitary to regulate pituitary hormone release
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6P6RJ32-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001320_AF2.pdbhor001320_ESM.pdb

Physical Information

Mass: 154871 Formula: C58H95N17O19
Absent amino acids: CDEHIKMNVWY Common amino acids: GLST
pI: 10.55 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: -9.23 Boman Index: -1589
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.69
Instability Index: 2580 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12473095
  • Title:  Novel fish hypothalamic neuropeptide.